PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g118290.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 847aa    MW: 94013.6 Da    PI: 6.7504
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g118290.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.6e-24146247199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      +  ++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   
  Sopim03g118290.0.1 146 FCKTLTASDTSTHGGFSVLRRHADEClpqldmS-RQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL-- 233
                         99****************************963.3334459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Sopim03g118290.0.1 234 RGENGELRVGVRRA 247
                         449999*****996 PP

2Auxin_resp120.61.2e-39272354183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++tk++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW +SkWr+Lk
  Sopim03g118290.0.1 272 AWHAIQTKTMFTVYYKPRTSPAEFIVPYDHYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWLESKWRCLK 354
                         89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-41142261IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.01E-40142275IPR015300DNA-binding pseudobarrel domain
CDDcd100172.61E-21144246No hitNo description
PROSITE profilePS5086312.012146248IPR003340B3 DNA binding domain
PfamPF023621.1E-21146247IPR003340B3 DNA binding domain
SMARTSM010191.4E-22146248IPR003340B3 DNA binding domain
PfamPF065071.2E-36272354IPR010525Auxin response factor
PfamPF023091.5E-10712805IPR033389AUX/IAA domain
SuperFamilySSF542771.72E-12717797No hitNo description
PROSITE profilePS5174525.219720804IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MAASEVSIQG YSEPSDGSRP VSETGRSSSG VGIVDADTAL YTELWRSCAG PLVTVPREGE  60
LVYYFPQGHI EQVEASTNQV ADQQMPLYNL PSKILCRVVN VLLKAEPDTD EVYAQVTLMP  120
EPNQDENAVK KEPMRPPPPR FHVHSFCKTL TASDTSTHGG FSVLRRHADE CLPQLDMSRQ  180
PPTQELVAKD LHGNEWRFRH IFRGQPRRHL LQSGWSVFVS SKRLVAGDAF IFLRGENGEL  240
RVGVRRAMRQ QGNAPSSVIS SHSMHLGVLA TAWHAIQTKT MFTVYYKPRT SPAEFIVPYD  300
HYMESVKNNY SIGMRFKMRF EGEEAPEQRF TGTIVGIEDA DPQRWLESKW RCLKVRWDEN  360
SSIPRPDRVS PWKIEPALSP PALNVPPVAR PKRPRSSILP TSPDSSVLTR EGSSRATADH  420
SQASGFPRVL QGQELSTFRG GFAEINETDL SEKPMIWQTS VNDEKNDIHS ASKRYLPDKW  480
LPLGRPESSL TDLLSGFGSS HGFCLPSADQ AAFGARLVKQ QTQDQEKDFS LLGKPWSLLS  540
SGLSLNLMDS GSKAPGIGGD TPYQMRGDAR YSGYGEFSVL PGHRVANQQG SWIMPQPVSP  600
YMQLSSHSRE MMHKPSVVKQ PEAVKPKEGN YKLFGIPLTS NVCTDAVMMR KSSLIDPASD  660
MNIGIHPHQS LATDSDQRSE QSKGSKVDDG VAANDHDKQF HTFHLAARDK DGKGHSSSTR  720
SCTKVHKQGT ALGRSVDLAK FNNYDELIAE LDQLFDFNGE LKARSKSWLV VYTDDEGDMM  780
LVGDDPWQEF CGMVRKIFIY TKEEVQRMNP GTLNSKGEDT SSVAEGSDAK EVKNLQLPSE  840
SGQAES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-174213761354Auxin response factor 1
4ldw_A1e-174213761354Auxin response factor 1
4ldw_B1e-174213761354Auxin response factor 1
4ldx_A1e-174213761354Auxin response factor 1
4ldx_B1e-174213761354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402550.0DQ340255.1 Lycopersicon esculentum auxin response factor 2 (ARF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233765.10.0auxin response factor 2
RefseqXP_010318416.10.0PREDICTED: auxin response factor 2 isoform X1
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLQ2LAJ30.0Q2LAJ3_SOLLC; Auxin response factor
STRINGSolyc03g118290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2